Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006723 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006723, RRID:AB_1847781
- Product name
- Anti-LIG3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQD
FLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLND
KQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFF
EQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Selective Killing of BRCA2-Deficient Ovarian Cancer Cells via MRE11 Blockade
Targeting Mre11 overcomes platinum resistance and induces synthetic lethality in XRCC1 deficient epithelial ovarian cancers
Loss of nuclear DNA ligase III reverts PARP inhibitor resistance in BRCA1/53BP1 double-deficient cells by exposing ssDNA gaps
NSG-Pro mouse model for uncovering resistance mechanisms and unique vulnerabilities in human luminal breast cancers
Linear mitochondrial DNA is rapidly degraded by components of the replication machinery
SUMOylation coordinates BERosome assembly in active DNA demethylation during cell differentiation
Knockout of Mpv17-Like Protein (M-LPH) Gene in Human Hepatoma Cells Results in Impairment of mtDNA Integrity through Reduction of TFAM, OGG1, and LIG3 at the Protein Levels.
Cells expressing FLT3/ITD mutations exhibit elevated repair errors generated through alternative NHEJ pathways: implications for genomic instability and therapy
Alblihy A, Ali R, Algethami M, Ritchie A, Shoqafi A, Alqahtani S, Mesquita K, Toss M, Ordóñez-Morán P, Jeyapalan J, Dekker L, Salerno M, Hartsuiker E, Grabowska A, Rakha E, Mongan N, Madhusudan S
International Journal of Molecular Sciences 2023;24(13):10966
International Journal of Molecular Sciences 2023;24(13):10966
Targeting Mre11 overcomes platinum resistance and induces synthetic lethality in XRCC1 deficient epithelial ovarian cancers
Alblihy A, Ali R, Algethami M, Shoqafi A, Toss M, Brownlie J, Tatum N, Hickson I, Moran P, Grabowska A, Jeyapalan J, Mongan N, Rakha E, Madhusudan S
npj Precision Oncology 2022;6(1)
npj Precision Oncology 2022;6(1)
Loss of nuclear DNA ligase III reverts PARP inhibitor resistance in BRCA1/53BP1 double-deficient cells by exposing ssDNA gaps
Paes Dias M, Tripathi V, van der Heijden I, Cong K, Manolika E, Bhin J, Gogola E, Galanos P, Annunziato S, Lieftink C, Andújar-Sánchez M, Chakrabarty S, Smith G, van de Ven M, Beijersbergen R, Bartkova J, Rottenberg S, Cantor S, Bartek J, Ray Chaudhuri A, Jonkers J
Molecular Cell 2021;81(22):4692-4708.e9
Molecular Cell 2021;81(22):4692-4708.e9
NSG-Pro mouse model for uncovering resistance mechanisms and unique vulnerabilities in human luminal breast cancers
Sun Y, Yang N, Utama F, Udhane S, Zhang J, Peck A, Yanac A, Duffey K, Langenheim J, Udhane V, Xia G, Peterson J, Jorns J, Nevalainen M, Rouet R, Schofield P, Christ D, Ormandy C, Rosenberg A, Chervoneva I, Tsaih S, Flister M, Fuchs S, Wagner K, Rui H
Science Advances 2021;7(38)
Science Advances 2021;7(38)
Linear mitochondrial DNA is rapidly degraded by components of the replication machinery
Peeva V, Blei D, Trombly G, Corsi S, Szukszto M, Rebelo-Guiomar P, Gammage P, Kudin A, Becker C, Altmüller J, Minczuk M, Zsurka G, Kunz W
Nature Communications 2018;9(1)
Nature Communications 2018;9(1)
SUMOylation coordinates BERosome assembly in active DNA demethylation during cell differentiation
Steinacher R, Barekati Z, Botev P, Kuśnierczyk A, Slupphaug G, Schär P
The EMBO Journal 2018;38(1)
The EMBO Journal 2018;38(1)
Knockout of Mpv17-Like Protein (M-LPH) Gene in Human Hepatoma Cells Results in Impairment of mtDNA Integrity through Reduction of TFAM, OGG1, and LIG3 at the Protein Levels.
Iida R, Ueki M, Yasuda T
Oxidative medicine and cellular longevity 2018;2018:6956414
Oxidative medicine and cellular longevity 2018;2018:6956414
Cells expressing FLT3/ITD mutations exhibit elevated repair errors generated through alternative NHEJ pathways: implications for genomic instability and therapy
Fan J, Li L, Small D, Rassool F
Blood 2010;116(24):5298-5305
Blood 2010;116(24):5298-5305
No comments: Submit comment
No validations: Submit validation data