HPA006723

antibody from Atlas Antibodies

Targeting: LIG3 LIG2, LIG3alpha

Western blot (Data presented on provider website)

Immunocytochemistry (Data presented on provider website)

Immunohistochemistry (Data presented on provider website)

Antibody Data

Product number

HPA006723

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA006723, RRID:AB_1847781

Product name

Anti-LIG3

Antibody type

Polyclonal

Reactivity

Human

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQD
FLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLND
KQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFF
EQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

Selective Killing of BRCA2-Deficient Ovarian Cancer Cells via MRE11 Blockade

Alblihy A, Ali R, Algethami M, Ritchie A, Shoqafi A, Alqahtani S, Mesquita K, Toss M, Ordóñez-Morán P, Jeyapalan J, Dekker L, Salerno M, Hartsuiker E, Grabowska A, Rakha E, Mongan N, Madhusudan S
International Journal of Molecular Sciences 2023;24(13):10966

---

Targeting Mre11 overcomes platinum resistance and induces synthetic lethality in XRCC1 deficient epithelial ovarian cancers

Alblihy A, Ali R, Algethami M, Shoqafi A, Toss M, Brownlie J, Tatum N, Hickson I, Moran P, Grabowska A, Jeyapalan J, Mongan N, Rakha E, Madhusudan S
npj Precision Oncology 2022;6(1)

---

Loss of nuclear DNA ligase III reverts PARP inhibitor resistance in BRCA1/53BP1 double-deficient cells by exposing ssDNA gaps

Paes Dias M, Tripathi V, van der Heijden I, Cong K, Manolika E, Bhin J, Gogola E, Galanos P, Annunziato S, Lieftink C, Andújar-Sánchez M, Chakrabarty S, Smith G, van de Ven M, Beijersbergen R, Bartkova J, Rottenberg S, Cantor S, Bartek J, Ray Chaudhuri A, Jonkers J
Molecular Cell 2021;81(22):4692-4708.e9

---

NSG-Pro mouse model for uncovering resistance mechanisms and unique vulnerabilities in human luminal breast cancers

Sun Y, Yang N, Utama F, Udhane S, Zhang J, Peck A, Yanac A, Duffey K, Langenheim J, Udhane V, Xia G, Peterson J, Jorns J, Nevalainen M, Rouet R, Schofield P, Christ D, Ormandy C, Rosenberg A, Chervoneva I, Tsaih S, Flister M, Fuchs S, Wagner K, Rui H
Science Advances 2021;7(38)

---

Linear mitochondrial DNA is rapidly degraded by components of the replication machinery

Peeva V, Blei D, Trombly G, Corsi S, Szukszto M, Rebelo-Guiomar P, Gammage P, Kudin A, Becker C, Altmüller J, Minczuk M, Zsurka G, Kunz W
Nature Communications 2018;9(1)

---

SUMOylation coordinates BERosome assembly in active DNA demethylation during cell differentiation

Steinacher R, Barekati Z, Botev P, Kuśnierczyk A, Slupphaug G, Schär P
The EMBO Journal 2018;38(1)

---

Knockout of Mpv17‐Like Protein (M‐LPH) Gene in Human Hepatoma Cells Results in Impairment of mtDNA Integrity through Reduction of TFAM, OGG1, and LIG3 at the Protein Levels

Iida R, Ueki M, Yasuda T, Carnevale G
Oxidative Medicine and Cellular Longevity 2018;2018(1)

---

Cells expressing FLT3/ITD mutations exhibit elevated repair errors generated through alternative NHEJ pathways: implications for genomic instability and therapy

Fan J, Li L, Small D, Rassool F
Blood 2010;116(24):5298-5305