HPA006723

LIG3 antibody from Sigma-Aldrich
LIG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006723, RRID:AB_1847781
Product name
Anti-LIG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006723
Antibody type
Polyclonal
Antigen
DNA ligase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQD
FLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLND
KQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFF
EQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE
Storage
-20C
Provider Type Product Number
- No reagents -