HPA019355

LRRC61 antibody from Sigma-Aldrich
FLJ31392, HSPC295, MGC3036
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019355
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019355, RRID:AB_1853339
Product name
Anti-LRRC61 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019355
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 61 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLR
LRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGE
RV
Storage
-20C
Provider Type Product Number
- No reagents -