HPA019355

LRRC61 antibody from Atlas Antibodies
FLJ31392, HSPC295, MGC3036
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019355
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019355, RRID:AB_1853339
Product name
Anti-LRRC61
Provider product page
Atlas Antibodies - HPA019355
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLR
LRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGE
RV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -