HPA019724

ZBED6CL antibody from Atlas Antibodies
C7orf29
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019724
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019724, RRID:AB_1845756
Product name
Anti-ZBED6CL
Provider product page
Atlas Antibodies - HPA019724
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSL
NSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQ
SSSHSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -