Antibody data

Product number
PAB21073
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21073, RRID:AB_10963991
Product name
C7orf29 polyclonal antibody
Provider product page
Abnova Corporation - PAB21073
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C7orf29.
Antigen sequence
GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSL
NSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQ
SSSHSG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -