HPA019724

ZBED6CL antibody from MilliporeSigma / Merck KGaA
C7orf29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019724
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019724, RRID:AB_1845756
Product name
Anti-C7orf29 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019724
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSL
NSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQ
SSSHSG
Storage
-20C
Provider Type Product Number
- No reagents -