HPA006782

PNKP antibody from Sigma-Aldrich
PNK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006782
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006782, RRID:AB_1855496
Product name
Anti-PNKP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006782
Antibody type
Polyclonal
Antigen
Bifunctional polynucleotide phosphatase/kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGD
TLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVS
QDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGV
KPQGKVAGFDLDGTLITTRSGKVFPTGP
Storage
-20C
Provider Type Product Number
- No reagents -