HPA018267

ARHGEF4 antibody from Sigma-Aldrich
ASEF, KIAA1112, STM6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018267
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018267, RRID:AB_1845006
Product name
Anti-ARHGEF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018267
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFR
LHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQ
LDQETG
Storage
-20C
Provider Type Product Number
- No reagents -