Antibody data

Product number
ABIN1107057
Provider
antibodies-online
Product name
anti-EF-Hand Calcium Binding Domain 3 (EFCAB3) (N-Term) antibody
Provider product page
antibodies-online - ABIN1107057
Antibody type
Polyclonal
Antigen
Synthetic peptide corresponding to the N-terminal of human EFCAB3
Description
Immunoaffinity column
Reactivity
Human
Host
Rabbit
Antigen sequence
MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQC
QLQHKEKKLSASQMA
Epitope
N-Term
Vial size
50 μg
Storage
Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -