Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107057 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-EF-Hand Calcium Binding Domain 3 (EFCAB3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to the N-terminal of human EFCAB3
- Description
- Immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQC
QLQHKEKKLSASQMA- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human NCI-H226; WB Suggested Anti-EFCAB3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: NCI-H226 cell lysate; EFCAB3 antibody - N-terminal region (AP46135PU-N) in Human NCI-H226 cells using Western Blot