HPA023317

EFCAB3 antibody from Sigma-Aldrich
FLJ25818
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023317
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023317, RRID:AB_2097450
Product name
Anti-EFCAB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023317
Antibody type
Polyclonal
Antigen
EF-hand calcium-binding domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQM
AAFQDAYNFFYKDKTGCIDFHGLMCTVAKLGMNLT
KHDVYNELKCADIDRDGK
Storage
-20C
Provider Type Product Number
- No reagents -