HPA020268

GIMAP7 antibody from Atlas Antibodies
IAN7, MGC27027
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020268
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020268, RRID:AB_1849682
Product name
Anti-GIMAP7
Provider product page
Atlas Antibodies - HPA020268
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKA
EKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEE
RLKQREEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -