H00055303-M05

GIMAP4 antibody from Abnova Corporation
FLJ11110, HIMAP4, IAN1, IMAP4

Antibody data

Product number
H00055303-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055303-M05, RRID:AB_1575190
Product name
GIMAP4 monoclonal antibody (M05), clone 1D8
Provider product page
Abnova Corporation - H00055303-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GIMAP4.
Antigen sequence
RYTEEEHKATEKILKMFGERARSFMILIFTRKDDL
GDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKAT
GAEQEAQRAQLLGLIQRVVRENKEGCYTNR
Isotype
IgG
Antibody clone number
1D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -