HPA019137

GIMAP4 antibody from Sigma-Aldrich
FLJ11110, HIMAP4, IAN1, IMAP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019137
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019137, RRID:AB_1849672
Product name
Anti-GIMAP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019137
Antibody type
Polyclonal
Antigen
GTPase IMAP family member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVL
VGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE
KRSSSWKETELVVVDTPG
Storage
-20C
Provider Type Product Number
- No reagents -