HPA019135

antibody from Atlas Antibodies

Targeting: GIMAP4 FLJ11110, HIMAP4, IAN1, IMAP4

Antibody data

Submit

Validation data

Product number: HPA019135 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019135, RRID:AB_1849670
Product name: Anti-GIMAP4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLG LIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQE LHRVELE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GIMAP4 protein structure - HPA019135 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-GIMAP4 antibody. Corresponding GIMAP4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, lymph node, testis and tonsil using Anti-GIMAP4 antibody HPA019135 (A) shows similar protein distribution across tissues to independent antibody HPA027198 (B).
Antibody #2 product nr: HPA027198
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong nuclear positivity in lymphoid cells outside reaction centra.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-GIMAP4 antibody HPA019135.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil using Anti-GIMAP4 antibody HPA019135.
Sample type: HUMAN