ABIN633330

antibody from antibodies-online

Targeting: MECOM EVI1, KMT8E, MDS1, MDS1-EVI1, PRDM3

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633330 - Provider product page
Provider: antibodies-online
Product name: anti-MDS1 and EVI1 Complex Locus (MECOM) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: EVI1 antibody was raised using the middle region of EVI1 corresponding to a region with amino acids KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MECOM protein structure - ABIN633330 shown in red.