Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183666 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-MDS1 and EVI1 Complex Locus (MECOM) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MDS1 antibody: synthetic peptide directed towards the N terminal of human MDS1
- Description
- Protein A purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGV
ASTPS LNIQEPCSPA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Intergenic splicing of MDS1 and EVI1 occurs in normal tissues as well as in myeloid leukemia and produces a new member of the PR domain family.
Fears S, Mathieu C, Zeleznik-Le N, Huang S, Rowley JD, Nucifora G
Proceedings of the National Academy of Sciences of the United States of America 1996 Feb 20;93(4):1642-7
Proceedings of the National Academy of Sciences of the United States of America 1996 Feb 20;93(4):1642-7
No comments: Submit comment
No validations: Submit validation data