Antibody data

Product number
H00011201-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011201-M01, RRID:AB_464103
Product name
POLI monoclonal antibody (M01), clone 8G9
Provider product page
Abnova Corporation - H00011201-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant POLI.
Antigen sequence
PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTD
SHKQTVATDSHEGLTENREPDSVDEKITFPSDIDP
QVFYELPEAVQKELLAEWKRAGSDFHIGHK
Isotype
IgG
Antibody clone number
8G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -