Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011201-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011201-M01, RRID:AB_464103
- Product name
- POLI monoclonal antibody (M01), clone 8G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant POLI.
- Antigen sequence
PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTD
SHKQTVATDSHEGLTENREPDSVDEKITFPSDIDP
QVFYELPEAVQKELLAEWKRAGSDFHIGHK- Isotype
- IgG
- Antibody clone number
- 8G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Both high-fidelity replicative and low-fidelity Y-family polymerases are involved in DNA rereplication.
Rev1, Rev3, or Rev7 siRNA Abolishes Ultraviolet Light-Induced Translesion Replication in HeLa Cells: A Comprehensive Study Using Alkaline Sucrose Density Gradient Sedimentation.
Evidence that in xeroderma pigmentosum variant cells, which lack DNA polymerase eta, DNA polymerase iota causes the very high frequency and unique spectrum of UV-induced mutations.
Sekimoto T, Oda T, Kurashima K, Hanaoka F, Yamashita T
Molecular and cellular biology 2015 Feb;35(4):699-715
Molecular and cellular biology 2015 Feb;35(4):699-715
Rev1, Rev3, or Rev7 siRNA Abolishes Ultraviolet Light-Induced Translesion Replication in HeLa Cells: A Comprehensive Study Using Alkaline Sucrose Density Gradient Sedimentation.
Takezawa J, Ishimi Y, Aiba N, Yamada K
Journal of nucleic acids 2010 Dec 1;2010:750296
Journal of nucleic acids 2010 Dec 1;2010:750296
Evidence that in xeroderma pigmentosum variant cells, which lack DNA polymerase eta, DNA polymerase iota causes the very high frequency and unique spectrum of UV-induced mutations.
Wang Y, Woodgate R, McManus TP, Mead S, McCormick JJ, Maher VM
Cancer research 2007 Apr 1;67(7):3018-26
Cancer research 2007 Apr 1;67(7):3018-26
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody (M01), clone 8G9.Lane 1: POLI transfected lysate(80.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- POLI monoclonal antibody (M01), clone 8G9. Western Blot analysis of POLI expression in U-2 OS.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged POLI is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
