HPA064696

POLI antibody from Atlas Antibodies
RAD30B, RAD3OB

Antibody data

Product number
HPA064696
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064696, RRID:AB_2685325
Product name
Anti-POLI
Provider product page
Atlas Antibodies - HPA064696
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PKDKETNRDFLPSGRIESTRTRESPLDTTNFSKEK
DINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKS
REKFQGKGSVSCPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -