HPA012000

POLI antibody from Sigma-Aldrich
RAD30B, RAD3OB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012000
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012000, RRID:AB_1847786
Product name
Anti-POLI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012000
Antibody type
Polyclonal
Antigen
DNA polymerase iota recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDV
LHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNK
LLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKE
IPGIGYKTAKCLEALGI
Storage
-20C
Provider Type Product Number
- No reagents -