Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012000 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-POLI
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDV
LHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNK
LLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKE
IPGIGYKTAKCLEALGI- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references RNA m6A methylation regulates the ultraviolet-induced DNA damage response
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Xiang Y, Laurent B, Hsu C, Nachtergaele S, Lu Z, Sheng W, Xu C, Chen H, Ouyang J, Wang S, Ling D, Hsu P, Zou L, Jambhekar A, He C, Shi Y
Nature 2017;543(7646):573-576
Nature 2017;543(7646):573-576
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
No comments: Submit comment
No validations: Submit validation data