Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182750 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myoneurin (MYNN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MYNN antibody: synthetic peptide directed towards the middle region of human MYNN
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIH
ARKHS GEKPYVCDRC- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cloning, recombinant expression and biochemical characterisation of novel esterases from Bacillus sp. associated with the marine sponge Aplysina aerophoba.
Neuromuscular expression of the BTB/POZ and zinc finger protein myoneurin.
Karpushova A, Brümmer F, Barth S, Lange S, Schmid RD
Applied microbiology and biotechnology 2005 Apr;67(1):59-69
Applied microbiology and biotechnology 2005 Apr;67(1):59-69
Neuromuscular expression of the BTB/POZ and zinc finger protein myoneurin.
Cifuentes-Diaz C, Bitoun M, Goudou D, Seddiqi N, Romero N, Rieger F, Perin JP, Alliel PM
Muscle & nerve 2004 Jan;29(1):59-65
Muscle & nerve 2004 Jan;29(1):59-65
No comments: Submit comment
No validations: Submit validation data