Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108362 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myoneurin (MYNN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MYNN antibody: synthetic peptide directed towards the middle region of human MYNN.
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
KSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEAS
SLRRHMRIHKGVKPY- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Neuromuscular expression of the BTB/POZ and zinc finger protein myoneurin.
Cifuentes-Diaz C, Bitoun M, Goudou D, Seddiqi N, Romero N, Rieger F, Perin JP, Alliel PM
Muscle & nerve 2004 Jan;29(1):59-65
Muscle & nerve 2004 Jan;29(1):59-65
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-MYNN Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate; MYNN antibody - middle region (AP42183PU-N) in Human HepG2 cells using Western Blot