HPA023322

MARCHF10 antibody from MilliporeSigma / Merck KGaA
FLJ35757, MARCH-X, MARCH10, RNF190
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023322
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023322, RRID:AB_1856351
Product name
Anti-MARCH10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023322
Antibody type
Polyclonal
Antigen
Probable E3 ubiquitin-protein ligase MARCH10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPDRESATEKDRGGSENAKKSPLSWDTKSEPRQEV
GVNAENVWSDCISVEHRPGTHDSEGYWKDYLNSSQ
NSLDYFISGRPISPRSSVNSSYNPPAS
Storage
-20C
Provider Type Product Number
- No reagents -