Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004350-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004350-M04, RRID:AB_565967
- Product name
- MPG monoclonal antibody (M04), clone 1E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MPG.
- Antigen sequence
MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQA
PAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIY
FSSPKGHLTRLGLEFFDQPA- Isotype
- IgG
- Antibody clone number
- 1E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair.
Chou WC, Wang HC, Wong FH, Ding SL, Wu PE, Shieh SY, Shen CY
The EMBO journal 2008 Dec 3;27(23):3140-50
The EMBO journal 2008 Dec 3;27(23):3140-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MPG monoclonal antibody (M04), clone 1E10 Western Blot analysis of MPG expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MPG expression in transfected 293T cell line by MPG monoclonal antibody (M04), clone 1E10.Lane 1: MPG transfected lysate(32.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MPG is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MPG on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
