HPA006531

MPG antibody from Sigma-Aldrich
MDG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006531, RRID:AB_1854075
Product name
Anti-MPG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006531
Antibody type
Polyclonal
Antigen
DNA-3-methyladenine glycosylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFCMNISSQGDGACVLLRALEPLEGLETMRQLRST
LRKGTASRVLKDRELCSGPSKLCQALAINKSFDQR
DLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGE
WARKPLRFYVRGS
Storage
-20C
Provider Type Product Number
- No reagents -