HPA020521

CAMSAP1 antibody from Sigma-Aldrich
DKFZp434F195, FLJ31228
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020521
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020521, RRID:AB_1845965
Product name
Anti-CAMSAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020521
Antibody type
Polyclonal
Antigen
Calmodulin-regulated spectrin-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEHFAKEYSQHNGEDCGDAVSKTEDFLVKEEQREE
LLHEPQDVDKESLAFAQQHKAKDPVALHELERNKV
ISAALLEDTVGEVVDVNECDLSIEKLNETISTL
Storage
-20C
Provider Type Product Number
- No reagents -