HPA024161

CAMSAP1 antibody from Sigma-Aldrich
DKFZp434F195, FLJ31228
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024161
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024161, RRID:AB_1845967
Product name
Anti-CAMSAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024161
Antibody type
Polyclonal
Antigen
Calmodulin-regulated spectrin-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQR
TLTLSSSKDANILSEQMSLKEVLDASVKEVGSSSS
DVSGKESVPVEEPLRSRASLIEVDLSDLK
Storage
-20C
Provider Type Product Number
- No reagents -