HPA012636

NUDT1 antibody from Sigma-Aldrich
MTH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012636
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012636, RRID:AB_1854696
Product name
Anti-NUDT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012636
Antibody type
Polyclonal
Antigen
7,8-dihydro-8-oxoguanine triphosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RWNGFGGKVQEGETIEDGARRELQEESGLTVDALH
KVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDE
MRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHG
YFKFQGQDTILDYTL
Storage
-20C
Provider Type Product Number
- No reagents -