Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010422-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010422-B01P, RRID:AB_10720701
- Product name
- UBAC1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human UBAC1 protein.
- Antigen sequence
MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTS
VEKLKERCLKHCAHGSLEDPKSITHHKLIHAASER
VLSDARTILEENIQDQDVLLLIKKRAPSPLPKMAD
VSAEEKKKQDQKAPDKEAILRATANLPSYNMDRAA
VQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVE
LFKKANAMLDEDEDERVDEAALRQLTEMGFPENRA
TKALQLNHMSVPQAMEWLIEHAEDPTIDTPLPGQA
PPEAEGATAAASEAAAGASATDEEARDELTEIFKK
IRRKREFRADARAVISLMEMGFDEKEVIDALRVNN
NQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAI
LDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMND
PETGPVMLQISRIFQTLNRT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UBAC1 expression in transfected 293T cell line (H00010422-T01) by UBAC1 MaxPab polyclonal antibody.Lane 1: UBADC1 transfected lysate(44.55 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBADC1 MaxPab polyclonal antibody. Western Blot analysis of UBADC1 expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to UBAC1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol