HPA005651

UBAC1 antibody from Sigma-Aldrich
GBDR1, UBADC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005651
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005651, RRID:AB_1858489
Product name
Anti-UBAC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005651
Antibody type
Polyclonal
Antigen
Ubiquitin-associated domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPS
PEELDKGIDPDSPLFQAILDNPVVQLGLTNPKTLL
AFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTL
NRT
Storage
-20C
Provider Type Product Number
- No reagents -