H00081033-M13

KCNH6 antibody from Abnova Corporation
erg2, HERG2, Kv11.2
No application information provided.

Antibody data

Product number
H00081033-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081033-M13, RRID:AB_1575693
Product name
KCNH6 monoclonal antibody (M13), clone 3D9
Provider product page
Abnova Corporation - H00081033-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant KCNH6.
Antigen sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQ
MENCAIIYCNDGFCELFGYSRVEVMQQPCTCDFLT
GPNTPSSAVSRLAQALLGAEECKVDILYYRKDASS
FRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKCS
SRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKY
RTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPH
KVVERTQNVTEKVTQVLSLGADVLPEYKLQAPRIH
RWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAF
LLSDQDESRRGACSYTCSPLTVVDLIVDIMFVVDI
VINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDM
VAAIPFDLLIFRTGSDETTTLIGLLKTARLLRLVR
VARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPAS
GPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNSEK
VFSICVMLIGCE
Isotype
IgG
Antibody clone number
3D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -