HPA011356

PCGF1 antibody from Atlas Antibodies
MGC10882, NSPC1, RNF68
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011356
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011356, RRID:AB_1855063
Product name
Anti-PCGF1
Provider product page
Atlas Antibodies - HPA011356
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPAL
SNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGK
DKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNP
QHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLL
QYSVK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -