ABIN630370

antibody from antibodies-online

Targeting: SLC7A14 KIAA1613, PPP1R142

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630370 - Provider product page
Provider: antibodies-online
Product name: anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14) antibody
Antibody type: Polyclonal
Antigen: SLC7 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
Description: Purified
Reactivity: Human, Mouse, Rat, Canine, Zebrafish
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SLC7A14 protein structure - ABIN630370 shown in red.