HPA045929

SLC7A14 antibody from Atlas Antibodies
KIAA1613, PPP1R142
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045929
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045929, RRID:AB_2679501
Product name
Anti-SLC7A14
Provider product page
Atlas Antibodies - HPA045929
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGD
NEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESE
NIYLIKLKKLIGPHYYTMRIRL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -