HPA021626

TACO1 antibody from MilliporeSigma / Merck KGaA
CCDC44
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021626
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021626, RRID:AB_1846148
Product name
Anti-CCDC44 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021626
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 44 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNS
KVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI
Storage
-20C
Provider Type Product Number
- No reagents -