H00138151-B01

NACC2 antibody from Abnova Corporation
BEND9, BTBD14A, BTBD31, MGC23427

Antibody data

Product number
H00138151-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00138151-B01, RRID:AB_1204016
Product name
BTBD14A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00138151-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human BTBD14A protein.
Antigen sequence
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIV
VKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP
GSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAG
FLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGS
EPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKH
EAMELPPAGPGLAPKRPLETGPRDGVAVAAGAAVA
AGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGE
RTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVE
EQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRR
DLVALPASLISQIGYRCHPKLYSEGDPGEKLELVA
GSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFD
RNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKI
KSMLPEGVEMYRTVMGSAAASVPLDPEFPPAAAQV
FEQRIYAERRGDAATIVALRTDAVNVDLSAAANPA
FDAGEEVDGAGSVIQEVAAPEPLPADGQSPPQPFE
QGGGGPSRPQTPAAAARRPEGTYAGTL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -