HPA052962

NACC2 antibody from Atlas Antibodies
BEND9, BTBD14A, BTBD31, MGC23427
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052962
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052962, RRID:AB_2681998
Product name
Anti-NACC2
Provider product page
Atlas Antibodies - HPA052962
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEP
VPLESRSCVLIRRDLVALPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -