AV34627

NACC2 antibody from Sigma-Aldrich
BEND9, BTBD14A, BTBD31, MGC23427
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV34627
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV34627, RRID:AB_1845472
Product name
Anti-BTBD14A antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV34627
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human BTBD14A with an internal ID of S07407
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
VKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP
GSVPPACFQQILSFC
Storage
-20C
Provider Type Product Number
- No reagents -