Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108039 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-LIM Homeobox 3 (LHX3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LHX3 antibody: synthetic peptide directed towards the middle region of human LHX3
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLA
EMGPANGLYGSLGEP- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Two promoters mediate transcription from the human LHX3 gene: involvement of nuclear factor I and specificity protein 1.
Yaden BC, Garcia M 3rd, Smith TP, Rhodes SJ
Endocrinology 2006 Jan;147(1):324-37
Endocrinology 2006 Jan;147(1):324-37
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-LHX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate; LHX3 antibody - middle region (AP42113PU-N) in Human Jurkat cells using Western Blot