Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108041 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-LIM Homeobox 3 (LHX3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LHX3 antibody: synthetic peptide directed towards the middle region of human LHX3
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKS
DKDSVQEGQDSDAEV- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Borjeson-Forssman-Lehmann syndrome: a novel pituitary phenotype due to mutation in a novel gene.
Dattani MT
Journal of pediatric endocrinology & metabolism : JPEM 2003 Dec;16(9):1207-9
Journal of pediatric endocrinology & metabolism : JPEM 2003 Dec;16(9):1207-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-LHX3 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysate; LHX3 antibody - middle region (AP42230PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Lung; LHX3 antibody - middle region (AP42230PU-N) in Human Lung cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Heart; LHX3 antibody - middle region (AP42230PU-N) in Human Heart cells using Immunohistochemistry