Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487105 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-LIM Homeobox 3 (LHX3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LHX3 antibody: synthetic peptide directed towards the middle region of human LHX3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
RLVCKADYETAKQREAEATAKRPRTTITAKQLETL
KSAYN TSPKPARHVR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Four novel mutations of the LHX3 gene cause combined pituitary hormone deficiencies with or without limited neck rotation.
Pfaeffle RW, Savage JJ, Hunter CS, Palme C, Ahlmann M, Kumar P, Bellone J, Schoenau E, Korsch E, Brämswig JH, Stobbe HM, Blum WF, Rhodes SJ
The Journal of clinical endocrinology and metabolism 2007 May;92(5):1909-19
The Journal of clinical endocrinology and metabolism 2007 May;92(5):1909-19
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting