Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503995 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Replication Protein A1, 70kDa (RPA1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSV
LSSST IIANPDIPEA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references DNA damage-induced ubiquitylation of RFC2 subunit of replication factor C complex.
Tomida J, Masuda Y, Hiroaki H, Ishikawa T, Song I, Tsurimoto T, Tateishi S, Shiomi T, Kamei Y, Kim J, Kamiya K, Vaziri C, Ohmori H, Todo T
The Journal of biological chemistry 2008 Apr 4;283(14):9071-9
The Journal of biological chemistry 2008 Apr 4;283(14):9071-9
No comments: Submit comment
No validations: Submit validation data