HPA006914

RPA1 antibody from Sigma-Aldrich
HSSB, REPA1, RF-A, RP-A, RPA70
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006914
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006914, RRID:AB_1856410
Product name
Anti-RPA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006914
Antibody type
Polyclonal
Antigen
Replication protein A 70 kDa DNA-binding subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNK
SQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQ
VDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDY
EMTFNNETSVMPCEDDHHLPTVQFDFTGIDD
Storage
-20C
Provider Type Product Number
- No reagents -