HPA043297

SPACA1 antibody from Atlas Antibodies
SAMP32
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043297
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043297, RRID:AB_2678413
Product name
Anti-SPACA1
Provider product page
Atlas Antibodies - HPA043297
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRQDQQSIILVNDSAILEVRKESHPLAFECDTLDN
NEIVATIKFTVYTSSELQMRRSSLPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -