Antibody data

Product number
H00060385-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00060385-M01, RRID:AB_1112584
Product name
TSKS monoclonal antibody (M01), clone 2E9
Provider product page
Abnova Corporation - H00060385-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TSKS.
Antigen sequence
ALTSLVDEVKQRGLTPACPSCQRLHKKILELERQA
LAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKP
EEKMATLDHLHLKMCSLHDH
Isotype
IgG
Antibody clone number
2E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -