Antibody data

Product number
ABIN311640
Provider
antibodies-online
Product name
anti-Testis-Specific serine Kinase Substrate (TSKS) antibody
Provider product page
antibodies-online - ABIN311640
Antibody type
Polyclonal
Antigen
The immunogen for anti-TSKS antibody: synthetic peptide directed towards the N terminal of human TSKS
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEA
PRRVT SRAKGIPKKK
Vial size
50 µg
Provider Type Product Number
- No reagents -