HPA003418

GZMB antibody from Atlas Antibodies
CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003418
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003418, RRID:AB_1079020
Product name
Anti-GZMB
Provider product page
Atlas Antibodies - HPA003418
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGK
HSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVG
DPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGM
PPRACTKVSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -