HPA003418

GZMB antibody from Sigma-Aldrich
CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003418
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003418, RRID:AB_1079020
Product name
Anti-GZMB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003418
Antibody type
Polyclonal
Antigen
Granzyme B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGK
HSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVG
DPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGM
PPRACTKVSS
Storage
-20C
Provider Type Product Number
- No reagents -