HPA006915

MDC1 antibody from Atlas Antibodies
Em:AB023051.5, KIAA0170, NFBD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006915
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006915, RRID:AB_1234815
Product name
Anti-MDC1
Provider product page
Atlas Antibodies - HPA006915
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
REAVLKDHTKIRALVRAHSEKDQPPFGDSDDSVEA
DKSSPGIHLERSQASTTVDINTQVEKEVPPGSAII
HIKKHQVSVEGTNQTDVKAVGGPAKLLVVSLEEAW
PLHGDCETDAEEGTSLTASVVADVRKSQLPAEGDA
G
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -